PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10012847
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 475aa    MW: 52768.9 Da    PI: 6.2135
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10012847genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.6e-143377348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +W+ eEd++l + + ++G+++W+ Ia++++  +t  qc+ rw++yl
      Lus10012847 33 SWSSEEDDILRQQISLHGTENWAIIASKFN-DKTTRQCRRRWFTYL 77
                     6*****************************.*************97 PP

2Myb_DNA-binding44.43.9e-1483126146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd+ll +a + +G++ W+ Ia+ +  gRt++ +k+r+ +
      Lus10012847  83 KGGWSPEEDLLLCEAQRIFGNR-WTEIAKVVS-GRTDNAVKNRFTT 126
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4642677IPR017930Myb domain
SMARTSM007171.5E-123079IPR001005SANT/Myb domain
SuperFamilySSF466891.35E-2531124IPR009057Homeodomain-like
CDDcd001677.65E-123377No hitNo description
Gene3DG3DSA:1.10.10.603.8E-203484IPR009057Homeodomain-like
PfamPF139214.8E-153493No hitNo description
PROSITE profilePS5129420.80678132IPR017930Myb domain
SMARTSM007176.4E-1582130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-1985131IPR009057Homeodomain-like
CDDcd001671.03E-1086127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MEEDKKKQMM INGGGGGSGS EESTKKKERH IVSWSSEEDD ILRQQISLHG TENWAIIASK  60
FNDKTTRQCR RRWFTYLNSD FKKGGWSPEE DLLLCEAQRI FGNRWTEIAK VVSGRTDNAV  120
KNRFTTLCKK RAKYEALAKE NEKGGCINAN NKRVLLDRKV NAAGNTENAT AAKRTRRSHI  180
PSRMENQNFG DRSHPKSRTQ QLRPPFMVLP PEVHKVNGGS QPPVDNENDI SSDGAQSKTQ  240
GTFLKKDDPK LSALVQQAEL LSTLALKVNS ESTDQSLEHA WKVLQNFLKS GKGDEVTSYA  300
LPDTDFQLED FKDLMEDLSS SDGSHSSWRQ PDLYEASPAS SEFSSGSSLI SYSAPDATEQ  360
PQGEIDMLQN DIETDLQIVP IEGQNGIGEC DNKIVSDDNI AEGNLFPSFS RELKAVGFAF  420
LSSIILSFIV NKSTSILGER RFLLKTLGVE SPFPNPTTNT SQQPPCKRVL LQSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-243413110107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012067595.10.0PREDICTED: uncharacterized protein LOC105630404 isoform X1
TrEMBLA0A067LAN90.0A0A067LAN9_JATCU; MYB family protein
STRINGPOPTR_0010s10310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.21e-134myb domain protein 88